Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRL Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ghrelin and obestatin prepropeptide

Gene Aliases

Appetite-regulating hormone; ghrelin, growth hormone secretagogue receptor ligand; ghrelin/obestatin preprohormone; ghrelin/obestatin prepropeptide; Growth hormone secretagogue; growth hormone-releasing peptide; In2c-preproghrelin; motilin-related peptide; MTLRP; prepro-appetite regulatory hormone; preproghrelin; Protein M46.

Gene ID

51738

Accession Number

NP_001128413

Reactivity

Homo sapiens|Human

Target

Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR) . Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.

Type

Protein

Source

E.coli

Sequence

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GHRL

Protein Name

Appetite-regulating hormone

Gene Name URL

GHRL

Nucleotide Accession Number

NM_001134941

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Complement C1q subcomponent subunit C (C1QC) ELISA Kit
MBS7221894-01 48 Well

Sheep Complement C1q subcomponent subunit C (C1QC) ELISA Kit

Sign In for Pricing
View Details
Sheep Complement C1q subcomponent subunit C (C1QC) ELISA Kit
MBS7221894-02 96 Well

Sheep Complement C1q subcomponent subunit C (C1QC) ELISA Kit

Sign In for Pricing
View Details
Sheep Complement C1q subcomponent subunit C (C1QC) ELISA Kit
MBS7221894-03 5x 96 Well

Sheep Complement C1q subcomponent subunit C (C1QC) ELISA Kit

Sign In for Pricing
View Details
Sheep Complement C1q subcomponent subunit C (C1QC) ELISA Kit
MBS7221894-04 10x 96 Well

Sheep Complement C1q subcomponent subunit C (C1QC) ELISA Kit

Sign In for Pricing
View Details
Mouse PON2 siRNA
abx929266-01 15 nmol

Mouse PON2 siRNA

Sign In for Pricing
View Details
Mouse PON2 siRNA
abx929266-02 30 nmol

Mouse PON2 siRNA

Sign In for Pricing
View Details