What is the catalog number for GBA3 Recombinant Protein (Human)?

The catalog number for GBA3 Recombinant Protein (Human) is OPCA04781-20UG.

What sizes are available for GBA3 Recombinant Protein (Human)?

GBA3 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is GBA3 Recombinant Protein (Human) in stock?

GBA3 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

GBA3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glucosylceramidase beta 3 (gene/pseudogene)

Gene Aliases

CBG; CBGL1; cytosolic beta-glucosidase; cytosolic beta-glucosidase-like protein 1; cytosolic GCase; cytosolic glycosylceramidase; GLUC; glucosidase beta acid 3; glucosidase, beta, acid 3 (cytosolic) ; klotho-related protein; KLRP.

Gene ID

57733

Accession Number

NP_001121904

Reactivity

Homo sapiens|Human

Target

Glycosidase probably involved in the intestinal absorption and metabolism of dietary flavonoid glycosides. Able to hydrolyze a broad variety of glycosides including phytoestrogens, flavonols, flavones, flavanones and cyanogens. Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide.

Type

Protein

Source

E.coli

Sequence

MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.