Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIRAS3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

DIRAS family GTPase 3

Gene Aliases

ARHI; DIRAS family, GTP-binding RAS-like 3; distinct subgroup of the Ras family member 3; GTP-binding protein Di-Ras3; NOEY2; ras homolog gene family, member I; rho-related GTP-binding protein RhoI.

Gene ID

9077

Accession Number

NP_004666

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DIRAS3

Protein Name

GTP-binding protein Di-Ras3

Gene Name URL

DIRAS3

Nucleotide Accession Number

NM_004675

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX11 Rabbit pAb
E45R28011N 50 ul

STX11 Rabbit pAb

Sign In for Pricing
View Details
KCTD11 Goat Polyclonal Antibody
TA311151 100 µg

KCTD11 Goat Polyclonal Antibody

Sign In for Pricing
View Details
LMO2 (LIM Domain Only Protein 2, Rhombotin-2, LMO-2, Cysteine-rich Protein TTG-2, RBTN2, RBTNL1, RHOM2, T-cell Translocation Protein 2, TTG2) (PE) discontinued
L3189-90A-PE 100 µL

LMO2 (LIM Domain Only Protein 2, Rhombotin-2, LMO-2, Cysteine-rich Protein TTG-2, RBTN2, RBTNL1, RHOM2, T-cell Translocation Protein 2, TTG2) (PE) discontinued

Sign In for Pricing
View Details
Human PTP1B Recombinant Protein
PROTP18031-01 20 µg

Human PTP1B Recombinant Protein

Sign In for Pricing
View Details
Human PTP1B Recombinant Protein
PROTP18031-02 500 µg

Human PTP1B Recombinant Protein

Sign In for Pricing
View Details
AP1AR Protein Lysate
OCOA18609-20UG 20 µg

AP1AR Protein Lysate

Sign In for Pricing
View Details