Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1A1L Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Casein kinase 1 alpha 1 like

Gene Aliases

Casein kinase I alpha S-like; casein kinase I isoform alpha-like; CK1; CKI-alpha-like.

Gene ID

122011

Accession Number

NP_660204

Reactivity

Homo sapiens|Human

Target

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling (By similarity) .

Type

Protein

Source

E.coli

Sequence

MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

66.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CSNK1A1L

Protein Name

Casein kinase I isoform alpha-like

Gene Name URL

CSNK1A1L

Nucleotide Accession Number

NM_145203

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
30274116 3x 1.0 µg

Moap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
RPL21P50 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
41054111 3x 1.0 µg

RPL21P50 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
1- (2-Chloro-3-methylpyridin-4-yl) ethanone
OR1058443-01 100 mg

1- (2-Chloro-3-methylpyridin-4-yl) ethanone

Sign In for Pricing
View Details
1- (2-Chloro-3-methylpyridin-4-yl) ethanone
OR1058443-02 250 mg

1- (2-Chloro-3-methylpyridin-4-yl) ethanone

Sign In for Pricing
View Details
1- (2-Chloro-3-methylpyridin-4-yl) ethanone
OR1058443-03 1 g

1- (2-Chloro-3-methylpyridin-4-yl) ethanone

Sign In for Pricing
View Details
RON, NT (p185-Ron, CDW136, CD136 antigen, MST1R, RON, Macrophage-stimulating protein receptor alpha chain, Macrophage-stimulating protein receptor beta chain, Macrophage-stimulating protein receptor MSPR, MSP receptor)
041164 200 µL

RON, NT (p185-Ron, CDW136, CD136 antigen, MST1R, RON, Macrophage-stimulating protein receptor alpha chain, Macrophage-stimulating protein receptor beta chain, Macrophage-stimulating protein receptor MSPR, MSP receptor)

Sign In for Pricing
View Details