Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA8 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Carbonic anhydrase 8

Gene Aliases

CALS; CAMRQ3; carbonate dehydratase; carbonic anhydrase VIII; carbonic anhydrase-like sequence; carbonic anhydrase-related protein; CA-related protein; CARP; CA-RP; CA-VIII.

Gene ID

767

Accession Number

NP_001308766

Reactivity

Homo sapiens|Human

Target

Does not have a carbonic anhydrase catalytic activity.

Type

Protein

Source

E.coli

Sequence

MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

60 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CA8

Protein Name

Carbonic anhydrase-related protein

Gene Name URL

CA8

Nucleotide Accession Number

NM_001321837

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTHB1, CT (BBS9, PTHB1, Protein PTHB1, Bardet-Biedl syndrome 9 protein, Parathyroid hormone-responsive B1 gene protein) (MaxLight 405)
MBS6338782-01 0.1 mL

PTHB1, CT (BBS9, PTHB1, Protein PTHB1, Bardet-Biedl syndrome 9 protein, Parathyroid hormone-responsive B1 gene protein) (MaxLight 405)

Sign In for Pricing
View Details
PTHB1, CT (BBS9, PTHB1, Protein PTHB1, Bardet-Biedl syndrome 9 protein, Parathyroid hormone-responsive B1 gene protein) (MaxLight 405)
MBS6338782-02 5x 0.1 mL

PTHB1, CT (BBS9, PTHB1, Protein PTHB1, Bardet-Biedl syndrome 9 protein, Parathyroid hormone-responsive B1 gene protein) (MaxLight 405)

Sign In for Pricing
View Details
Neuropeptide Y (13-36) (porcine)
N2176-62C 1 mg

Neuropeptide Y (13-36) (porcine)

Sign In for Pricing
View Details
Mkl2 (NM_153588) Mouse Tagged Lenti ORF Clone
MR225283L3 10 µg

Mkl2 (NM_153588) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal MDR1/ABCB1 Antibody (MDR1/8986R) [DyLight 594]
NBP3-24231DL594 0.1 mL

Rabbit Monoclonal MDR1/ABCB1 Antibody (MDR1/8986R) [DyLight 594]

Sign In for Pricing
View Details
ROPN1L 3'UTR Lenti-reporter-Luc Vector
40684081 1.0 µg

ROPN1L 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details