What is the catalog number for ASCC3 Recombinant Protein (Human)?

The catalog number for ASCC3 Recombinant Protein (Human) is OPCA04768-1MG.

What sizes are available for ASCC3 Recombinant Protein (Human)?

ASCC3 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is ASCC3 Recombinant Protein (Human) in stock?

ASCC3 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

ASCC3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Activating signal cointegrator 1 complex subunit 3

Gene Aliases

Activating signal cointegrator 1 complex subunit 3; ASC-1 complex subunit P200; ASC1p200; HELIC1; helicase, ATP binding 1; RNA helicase family; RNAH; trip4 complex subunit p200.

Gene ID

10973

Accession Number

NP_001271200

Reactivity

Homo sapiens|Human

Target

3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.

Type

Protein

Source

E.coli

Sequence

MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.