What is the catalog number for ACP1 Recombinant Protein (Human)?

The catalog number for ACP1 Recombinant Protein (Human) is OPCA04761-20UG.

What sizes are available for ACP1 Recombinant Protein (Human)?

ACP1 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is ACP1 Recombinant Protein (Human) in stock?

ACP1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

ACP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Acid phosphatase 1

Gene Aliases

Acid phosphatase 1, soluble; acid phosphatase of erythrocyte; adipocyte acid phosphatase; cytoplasmic phosphotyrosyl protein phosphatase; HAAP; LMWPTP; LMW-PTP; LMW-PTPase; low molecular weight cytosolic acid phosphatase; low molecular weight phosphotyrosine protein phosphatase; protein tyrosine phosphatase; red cell acid phosphatase 1; testicular secretory protein Li 37.

Gene ID

Accession Number

NP_004291

Reactivity

Homo sapiens|Human

Target

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

Type

Protein

Source

E.coli

Sequence

MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.