Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBX1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ring-box 1

Gene Aliases

BA554C12.1; E3 ubiquitin-protein ligase RBX1; E3 ubiquitin-protein transferase RBX1; Protein ZYP; regulator of cullins 1; RING finger protein 75; ring-box 1, E3 ubiquitin protein ligase; RING-box protein 1; RNF75; ROC1; ZYP protein.

Gene ID

9978

Accession Number

NP_055063

Reactivity

Homo sapiens|Human

Target

E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (PubMed:27565346) . The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex promotes the ubiquitination of ERCC6 resulting in proteasomal degradation. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme, like CDC34, to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41. In concert with ATF2 and CUL3, promotes degradation of KAT5 thereby attenuating its ability to acetylate and activate ATM.

Type

Protein

Source

E.coli

Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RBX1

Protein Name

E3 ubiquitin-protein ligase RBX1

Gene Name URL

RBX1

Nucleotide Accession Number

NM_014248

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TY1B-OR Polyclonal Antibody
MBS9004177 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TY1B-OR Polyclonal Antibody

Sign In for Pricing
View Details
CG6856-PA Rabbit Polyclonal Antibody (BF750)
orb2556420 100 µL

CG6856-PA Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
NMDAε1 CRISPR/Cas9 KO Plasmid (m)
sc-420689 20 µg

NMDAε1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Mouse Protein Kinase C Theta (PKCq) ELISA Kit
orb1947118-01 48 Tests

Mouse Protein Kinase C Theta (PKCq) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Kinase C Theta (PKCq) ELISA Kit
orb1947118-02 96 Tests

Mouse Protein Kinase C Theta (PKCq) ELISA Kit

Sign In for Pricing
View Details
Fcgr3 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4361902 1.0 µg DNA

Fcgr3 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details