Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP5 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fatty acid binding protein 5

Gene Aliases

EFABP; E-FABP; epidermal-type fatty acid-binding protein; fatty acid binding protein 5 (psoriasis-associated) ; fatty acid-binding protein 5; Fatty acid-binding protein, epidermal; KFABP; PAFABP; PA-FABP; psoriasis-associated fatty acid-binding protein homolog.

Gene ID

2171

Accession Number

NP_001435

Reactivity

Homo sapiens|Human

Target

Intracellular carrier for long-chain fatty acids and related active lipids, such as the endocannabinoid, that regulates the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors (PubMed:22170058) . Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation (By similarity) . May be involved in keratinocyte differentiation (PubMed:8092987) .

Type

Protein

Source

E.coli

Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FABP5

Protein Name

Fatty acid-binding protein 5

Gene Name URL

FABP5

Nucleotide Accession Number

NM_001444

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Antibody
C30333-01 50 μL

CD19 Antibody

Sign In for Pricing
View Details
CD19 Antibody
C30333-02 100 µL

CD19 Antibody

Sign In for Pricing
View Details
Claudin-19 siRNA (m)
sc-142364 10 µM

Claudin-19 siRNA (m)

Sign In for Pricing
View Details
Goat C type lectin domain family 18 member B (CLEC18B) ELISA kit
GTR10441449 96 Well

Goat C type lectin domain family 18 member B (CLEC18B) ELISA kit

Sign In for Pricing
View Details
Human IL-17B Alexa Fluor 647 Antibody (Clone 174113)
IC1248R-100UG 100 µg

Human IL-17B Alexa Fluor 647 Antibody (Clone 174113)

Sign In for Pricing
View Details
HIV-1 env gp41, Recombinant (Human Immunodeficiency Virus-1)
H6003-16-01 100 µg

HIV-1 env gp41, Recombinant (Human Immunodeficiency Virus-1)

Sign In for Pricing
View Details