Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB9 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Serpin family B member 9

Gene Aliases

CAP3; CAP-3; cytoplasmic antiproteinase 3; peptidase inhibitor 9; PI9; PI-9; protease inhibitor 9 (ovalbumin type) ; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; serpin B9; serpin peptidase inhibitor, clade B (ovalbumin), member 9; serpin peptidase inhibitor, clade B, member 9; testicular tissue protein Li 180.

Gene ID

5272

Accession Number

NP_004146

Reactivity

Homo sapiens|Human

Target

Granzyme B inhibitor.

Type

Protein

Source

E.coli

Sequence

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

69.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SERPINB9

Protein Name

Serpin B9

Gene Name URL

SERPINB9

Nucleotide Accession Number

NM_004155

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quick Step Human Platelet-Derived Growth Factor AB, PDGF-AB ELISA kit
QS1422Hu-01 48 Tests

Quick Step Human Platelet-Derived Growth Factor AB, PDGF-AB ELISA kit

Sign In for Pricing
View Details
Quick Step Human Platelet-Derived Growth Factor AB, PDGF-AB ELISA kit
QS1422Hu-02 96 Tests

Quick Step Human Platelet-Derived Growth Factor AB, PDGF-AB ELISA kit

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila UPF0270 protein PSEEN1465 (PSEEN1465)
MBS1421692-01 0.02 mg (E-Coli)

Recombinant Pseudomonas entomophila UPF0270 protein PSEEN1465 (PSEEN1465)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila UPF0270 protein PSEEN1465 (PSEEN1465)
MBS1421692-02 0.1 mg (E-Coli)

Recombinant Pseudomonas entomophila UPF0270 protein PSEEN1465 (PSEEN1465)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila UPF0270 protein PSEEN1465 (PSEEN1465)
MBS1421692-03 0.02 mg (Yeast)

Recombinant Pseudomonas entomophila UPF0270 protein PSEEN1465 (PSEEN1465)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila UPF0270 protein PSEEN1465 (PSEEN1465)
MBS1421692-04 0.1 mg (Yeast)

Recombinant Pseudomonas entomophila UPF0270 protein PSEEN1465 (PSEEN1465)

Sign In for Pricing
View Details