Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGN4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

High mobility group nucleosomal binding domain 4

Gene Aliases

High mobility group nucleosome-binding domain-containing protein 4; high mobility group protein N4; high-mobility group (nonhistone chromosomal) protein 17-like 3; high-mobility group protein 17-like 3; HMG17L3; NHC; non-histone chromosomal protein HMG-17-like 3.

Gene ID

10473

Accession Number

NP_006344

Reactivity

Homo sapiens|Human

Target

Non-histone chromosomal protein HMG-17-like 3

Type

Protein

Source

E.coli

Sequence

MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HMGN4

Protein Name

High mobility group nucleosome-binding domain-containing protein 4

Gene Name URL

HMGN4

Nucleotide Accession Number

NM_006353

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP2 Mouse Monoclonal Antibody (PerCP)
orb2972055-01 50 Tests

BMP2 Mouse Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details
BMP2 Mouse Monoclonal Antibody (PerCP)
orb2972055-02 100 Tests

BMP2 Mouse Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details
Human Anti-HIV-1 Env Recombinant Antibody
TRI-AB-075 0.1mg

Human Anti-HIV-1 Env Recombinant Antibody

Sign In for Pricing
View Details
DRD5 Recombinant Protein (Rat)
RP198674 100 µg

DRD5 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal RCAN2 Antibody
NBP1-76995 0.1 mg

Rabbit Polyclonal RCAN2 Antibody

Sign In for Pricing
View Details
UNC5D, ID (UNC5D, KIAA1777, UNC5H4, Netrin receptor UNC5D, Protein unc-5 homolog 4, Protein unc-5 homolog D) (MaxLight 750) discontinued
043615-ML750 100 µL

UNC5D, ID (UNC5D, KIAA1777, UNC5H4, Netrin receptor UNC5D, Protein unc-5 homolog 4, Protein unc-5 homolog D) (MaxLight 750) discontinued

Sign In for Pricing
View Details