Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLRX2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutaredoxin 2

Gene Aliases

BA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2) ; CGI-133; glutaredoxin (thioltransferase) 2; glutaredoxin 2; GRX2.

Gene ID

51022

Accession Number

NP_001230328

Reactivity

Homo sapiens|Human

Target

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.

Type

Protein

Source

E.coli

Sequence

MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GLRX2

Protein Name

Glutaredoxin-2, mitochondrial

Gene Name URL

GLRX2

Nucleotide Accession Number

NM_001243399

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAP2 Human shRNA Plasmid Kit (Locus ID 64744)
TL301510 1 Kit

SMAP2 Human shRNA Plasmid Kit (Locus ID 64744)

Sign In for Pricing
View Details
Cox6a1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3402503 1.0 µg DNA

Cox6a1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) benzo[b]furan
sc-260459A 1 g

3- (4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) benzo[b]furan

Sign In for Pricing
View Details
1- (6-Chlorobenzo[d]thiazol-2-yl) hydrazine ≥97% (HPLC) discontinued
228536-01 1 g

1- (6-Chlorobenzo[d]thiazol-2-yl) hydrazine ≥97% (HPLC) discontinued

Sign In for Pricing
View Details
1- (6-Chlorobenzo[d]thiazol-2-yl) hydrazine ≥97% (HPLC) discontinued
228536-02 5 g

1- (6-Chlorobenzo[d]thiazol-2-yl) hydrazine ≥97% (HPLC) discontinued

Sign In for Pricing
View Details
1- (6-Chlorobenzo[d]thiazol-2-yl) hydrazine ≥97% (HPLC) discontinued
228536-03 25 g

1- (6-Chlorobenzo[d]thiazol-2-yl) hydrazine ≥97% (HPLC) discontinued

Sign In for Pricing
View Details