Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT8 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

CCR4-NOT transcription complex subunit 8

Gene Aliases

CAF1; Caf1b; CAF1-like protein; CAF2; CALIF; CALIFp; CCR4-associated factor 8; CCR4-NOT transcription complex subunit 8; hCAF1; PGK promoter directed over production; POP2.

Gene ID

9337

Accession Number

NP_001288002

Reactivity

Homo sapiens|Human

Target

Has 3'-5' poly (A) exoribonuclease activity for synthetic poly (A) RNA substrate. Its function seems to be partially redundant with that of CNOT7. Catalytic component of the CCR4-NOT complex which is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.

Type

Protein

Source

E.coli

Sequence

MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

60.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CNOT8

Protein Name

CCR4-NOT transcription complex subunit 8

Gene Name URL

CNOT8

Nucleotide Accession Number

NM_001301073

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nnmt sgRNA CRISPR Lentivector (Rat) (Target 2)
K6711703 1.0 µg DNA

Nnmt sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
UCHL5 antibody
70R-21140 50 ul

UCHL5 antibody

Sign In for Pricing
View Details
1,3-Adamantanediacetic acid
FA03010-01 5 g

1,3-Adamantanediacetic acid

Sign In for Pricing
View Details
1,3-Adamantanediacetic acid
FA03010-02 10 g

1,3-Adamantanediacetic acid

Sign In for Pricing
View Details
1,3-Adamantanediacetic acid
FA03010-03 25 g

1,3-Adamantanediacetic acid

Sign In for Pricing
View Details
1,3-Adamantanediacetic acid
FA03010-04 50 g

1,3-Adamantanediacetic acid

Sign In for Pricing
View Details