Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCND2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cyclin D2

Gene Aliases

G1/S-specific cyclin-D2; KIAK0002; MPPH3.

Gene ID

894

Accession Number

NP_001750

Reactivity

Homo sapiens|Human

Target

Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G (1) /S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G (1) phase. Hypophosphorylates RB1 in early G (1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D2/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity) .

Type

Protein

Source

E.coli

Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

60.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCND2

Protein Name

G1/S-specific cyclin-D2

Gene Name URL

CCND2

Nucleotide Accession Number

NM_001759

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE1B sgRNA CRISPR Lentivector (Human) (Target 3)
K1617504 1.0 µg DNA

PDE1B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Osteocalcin Polyclonal Antibody Cy3 Conjugated
C05448Cy3 100 µL

Osteocalcin Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal NDUFA7 Antibody (OTI2G4) [Dylight 594]
NBP2-72909DL594 0.1 mL

Mouse Monoclonal NDUFA7 Antibody (OTI2G4) [Dylight 594]

Sign In for Pricing
View Details
KRT84 (NM_033045) Human Over-expression Lysate
LS003890-100ug 100 µg

KRT84 (NM_033045) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-FCGR1B Antibody
CQA4450-01 30 µL

Anti-FCGR1B Antibody

Sign In for Pricing
View Details
Anti-FCGR1B Antibody
CQA4450-02 50 μL

Anti-FCGR1B Antibody

Sign In for Pricing
View Details