Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APRT Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Adenine phosphoribosyltransferase

Gene Aliases

Adenine phosphoribosyltransferase; AMP; AMP diphosphorylase; AMP pyrophosphorylase; APRTD; transphosphoribosidase.

Gene ID

353

Accession Number

NP_000476

Reactivity

Homo sapiens|Human

Target

Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Type

Protein

Source

E.coli

Sequence

ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

46.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

APRT

Protein Name

Adenine phosphoribosyltransferase

Gene Name URL

APRT

Nucleotide Accession Number

NM_000485

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ICK shRNA (UAS) - Lentiviral human ICK shRNA (UAS, iRFP) (100)
GTR15321354 1 Vial

Lentiviral human ICK shRNA (UAS) - Lentiviral human ICK shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
MAFK, CT (v-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog K (Avian), MAFK Protein, FLJ32205, MGC71717, NFE2U, P18) (MaxLight 490) discontinued
M1740-65-ML490 100 µL

MAFK, CT (v-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog K (Avian), MAFK Protein, FLJ32205, MGC71717, NFE2U, P18) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human DUX4L5 knockdown cell line
ABC-KD4509 1 Vial

Human DUX4L5 knockdown cell line

Sign In for Pricing
View Details
MT1L 3'UTR Luciferase Stable Cell Line
TU014838 1.0 mL

MT1L 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TRIM31 Antibody
A37496-100UL 100 µL

TRIM31 Antibody

Sign In for Pricing
View Details
Tetramethyl N, N, O-Trimethyl Alendronate-d6
467408-01 1 mg

Tetramethyl N, N, O-Trimethyl Alendronate-d6

Sign In for Pricing
View Details