What is the catalog number for DEFA1 MORE Recombinant Protein (Human)?

The catalog number for DEFA1 MORE Recombinant Protein (Human) is OPCA04723-1MG.

What sizes are available for DEFA1 MORE Recombinant Protein (Human)?

DEFA1 MORE Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is DEFA1 MORE Recombinant Protein (Human) in stock?

DEFA1 MORE Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

DEFA1 MORE Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Defensin alpha 1|defensin alpha 1B

Gene Aliases

DEF1; DEFA2; Defensin, alpha 1; defensin, alpha 1, myeloid-related sequence; defensin, alpha 2; HNP-1; HP1; HP-1; MRS; myeloid-related sequence; neutrophil defensin 1.

Gene ID

1667|728358

Accession Number

NP_001035965

Reactivity

Homo sapiens|Human

Target

Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Type

Protein

Source

E.coli

Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.