Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEFA1 MORE Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Defensin alpha 1|defensin alpha 1B

Gene Aliases

DEF1; DEFA2; Defensin, alpha 1; defensin, alpha 1, myeloid-related sequence; defensin, alpha 2; HNP-1; HP1; HP-1; MRS; myeloid-related sequence; neutrophil defensin 1.

Gene ID

1667|728358

Accession Number

NP_001035965

Reactivity

Homo sapiens|Human

Target

Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Type

Protein

Source

E.coli

Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DEFA1|DEFA1B

Protein Name

Neutrophil defensin 1

Gene Name URL

DEFA1|DEFA1B

Nucleotide Accession Number

NM_001042500

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MPIF2 Matched Antibody Pair Set [ABP-S-04809]
ABP-S-04809 5 Plates

Mouse MPIF2 Matched Antibody Pair Set [ABP-S-04809]

Sign In for Pricing
View Details
Anti- Endotoxin Monoclonal antibody, Clone C50/33
DCABY-051 500 µg

Anti- Endotoxin Monoclonal antibody, Clone C50/33

Sign In for Pricing
View Details
Recombinant Carassius auratus Glial fibrillary acidic protein (gfap)
MBS1180651-01 0.02 mg (E-Coli)

Recombinant Carassius auratus Glial fibrillary acidic protein (gfap)

Sign In for Pricing
View Details
Recombinant Carassius auratus Glial fibrillary acidic protein (gfap)
MBS1180651-02 0.02 mg (Yeast)

Recombinant Carassius auratus Glial fibrillary acidic protein (gfap)

Sign In for Pricing
View Details
Recombinant Carassius auratus Glial fibrillary acidic protein (gfap)
MBS1180651-03 0.1 mg (E-Coli)

Recombinant Carassius auratus Glial fibrillary acidic protein (gfap)

Sign In for Pricing
View Details
Recombinant Carassius auratus Glial fibrillary acidic protein (gfap)
MBS1180651-04 0.1 mg (Yeast)

Recombinant Carassius auratus Glial fibrillary acidic protein (gfap)

Sign In for Pricing
View Details