Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNBIP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Catenin beta interacting protein 1

Gene Aliases

Beta-catenin-interacting protein 1; beta-catenin-interacting protein ICAT; ICAT; inhibitor of beta-catenin and Tcf-4.

Gene ID

56998

Accession Number

NP_001012329

Reactivity

Homo sapiens|Human

Target

Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.

Type

Protein

Source

E.coli

Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CTNNBIP1

Protein Name

Beta-catenin-interacting protein 1

Gene Name URL

CTNNBIP1

Nucleotide Accession Number

NM_001012329

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apc11 (ANAPC11) Human Over-expression Lysate
orb1342108 100 µg

Apc11 (ANAPC11) Human Over-expression Lysate

Sign In for Pricing
View Details
ARRDC3 Antibody
A25307-50UG 50 µg

ARRDC3 Antibody

Sign In for Pricing
View Details
YIPF5, NT (YIPF5, FINGER5, YIP1A, Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, YIP1 family member 5, YPT-interacting protein 1 A) (MaxLight 750) discontinued
043957-ML750 100 µL

YIPF5, NT (YIPF5, FINGER5, YIP1A, Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, YIP1 family member 5, YPT-interacting protein 1 A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
INSL4 Protein Vector (Human) (pPM-C-HA)
24997021 500 ng

INSL4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human SENP1/Sentrin-specific protease 1 ELISA Kit
MBS2907394-01 48 Well

Human SENP1/Sentrin-specific protease 1 ELISA Kit

Sign In for Pricing
View Details
Human SENP1/Sentrin-specific protease 1 ELISA Kit
MBS2907394-02 96 Well

Human SENP1/Sentrin-specific protease 1 ELISA Kit

Sign In for Pricing
View Details