Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Elongin B

Gene Aliases

Elongin 18 kDa subunit; elongin, 18-kD subunit; elongin-B; epididymis secretory sperm binding protein; RNA polymerase II transcription factor SIII p18 subunit; RNA polymerase II transcription factor SIII subunit B; SIII; SIII p18; TCEB2; transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) ; transcription elongation factor B polypeptide 2; transcription elongation factor B subunit 2.

Gene ID

6923

Accession Number

NP_009039

Reactivity

Homo sapiens|Human

Target

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7638163) . In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity) .

Type

Protein

Source

E.coli

Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ELOB

Protein Name

Elongin-B

Gene Name URL

ELOB

Nucleotide Accession Number

NM_007108

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HENMT1 (NM_001102592) Human Over-expression Lysate
LY420162 100 µg

HENMT1 (NM_001102592) Human Over-expression Lysate

Sign In for Pricing
View Details
PSMA2 Recombinant Antibody, RBITC Conjugated
bsm-62091R-RBITC-01 20 µL

PSMA2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PSMA2 Recombinant Antibody, RBITC Conjugated
bsm-62091R-RBITC-02 100 µL

PSMA2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Chicken Olfactory receptor 4X1 (OR4X1) ELISA Kit
GTR10325411 96 Well

Chicken Olfactory receptor 4X1 (OR4X1) ELISA Kit

Sign In for Pricing
View Details
LSM1 Antibody (YA8013, Mouse)
HY-P88329-01 10 µL

LSM1 Antibody (YA8013, Mouse)

Sign In for Pricing
View Details
LSM1 Antibody (YA8013, Mouse)
HY-P88329-02 50 μL

LSM1 Antibody (YA8013, Mouse)

Sign In for Pricing
View Details