What is the catalog number for AK2 Recombinant Protein (Human)?

The catalog number for AK2 Recombinant Protein (Human) is OPCA04712-20UG.

What sizes are available for AK2 Recombinant Protein (Human)?

AK2 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is AK2 Recombinant Protein (Human) in stock?

AK2 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

AK2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Adenylate kinase 2

Gene Aliases

Adenylate kinase 2, mitochondrial; adenylate kinase isoenzyme 2, mitochondrial; adenylate monophosphate kinase; ADK2; ATP:AMP phosphotransferase; ATP-AMP transphosphorylase 2; testis secretory sperm-binding protein Li 220n.

Gene ID

204

Accession Number

NP_001186128

Reactivity

Homo sapiens|Human

Target

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Adenylate kinase activity is critical for regulation of the phosphate utilization and the AMP de novo biosynthesis pathways. Plays a key role in hematopoiesis.

Type

Protein

Source

E.coli

Sequence

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.