Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Nuclear cap binding protein subunit 2

Gene Aliases

20 kDa nuclear cap-binding protein; CBC2; CBP20; cell proliferation-inducing gene 55 protein; NCBP 20 kDa subunit; NCBP interacting protein 1; NCBP-interacting protein 1; NIP1; nuclear cap binding protein subunit 2, 20kD; nuclear cap binding protein subunit 2, 20kDa; nuclear cap-binding protein subunit 2; PIG55.

Gene ID

22916

Accession Number

NP_001036005

Reactivity

Homo sapiens|Human

Target

Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus via its interaction with ALYREF/THOC4/ALY, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD) . During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA-mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure. The conventional cap-binding complex with NCBP2 binds both small nuclear RNA (snRNA) and messenger (mRNA) and is involved in their export from the nucleus (PubMed:26382858) .

Type

Protein

Source

E.coli

Sequence

SGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NCBP2

Protein Name

Nuclear cap-binding protein subunit 2

Gene Name URL

NCBP2

Nucleotide Accession Number

NM_001042540

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse MSL2 Protein, His (Fc)-Avi-tagged
MSL2-5743M 50 µg

Recombinant Mouse MSL2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
STK11 Antibody
E92122 100 µL

STK11 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gtf2h3 shRNA (UAS) - Lentiviral mouseGtf2h3 shRNA (UAS, GFP) (25)
GTR15288968 1 Vial

Lentiviral mouse Gtf2h3 shRNA (UAS) - Lentiviral mouseGtf2h3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SLA Class II DR (SLA-2 DR) Antibody
abx414024 100 µg

SLA Class II DR (SLA-2 DR) Antibody

Sign In for Pricing
View Details
MMP8 discontinued
324220 100 µL

MMP8 discontinued

Sign In for Pricing
View Details
EFHA2 Peptide - N-terminal region
MBS3237356-01 0.1 mg

EFHA2 Peptide - N-terminal region

Sign In for Pricing
View Details