Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP6 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fatty acid binding protein 6

Gene Aliases

Fatty acid binding protein 6, ileal; Fatty acid-binding protein 6; gastrotropin; GT; I-15P; I-BABP; I-BALB; I-BAP; ILBP; ILBP3; ileal bile acid binding protein; ileal lipid-binding protein; ILLBP; illeal lipid-binding protein; intestinal 15 kDa protein; Intestinal bile acid-binding protein.

Gene ID

2172

Accession Number

NP_001035532

Reactivity

Homo sapiens|Human

Target

Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes (By similarity) . In vitro binds to bile acids in the order: deoxycholic acid > cholic acid > chenodeoxycholic acid and respective BA conjugation modifies affinities in the order taurine-conjugated > glycine-conjugated > unconjugated bile acids. Stimulates gastric acid and pepsinogen secretion (By similarity) .

Type

Protein

Source

E.coli

Sequence

MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FABP6

Protein Name

Gastrotropin

Gene Name URL

FABP6

Nucleotide Accession Number

NM_001040442

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1E Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV620894 1.0 µg DNA

POLR1E Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
12β-Hydroxy-5β-cholan-24-oic Acid
411955 2.5 mg

12β-Hydroxy-5β-cholan-24-oic Acid

Sign In for Pricing
View Details
COX6C Conjugated Antibody
MBS9445047-01 0.1 mL (Biotin)

COX6C Conjugated Antibody

Sign In for Pricing
View Details
COX6C Conjugated Antibody
MBS9445047-02 0.1 mL (AF350)

COX6C Conjugated Antibody

Sign In for Pricing
View Details
COX6C Conjugated Antibody
MBS9445047-03 0.1 mL (AF405)

COX6C Conjugated Antibody

Sign In for Pricing
View Details
COX6C Conjugated Antibody
MBS9445047-04 0.1 mL (AF488)

COX6C Conjugated Antibody

Sign In for Pricing
View Details