What is the catalog number for SULT1A1 Recombinant Protein (Human)?

The catalog number for SULT1A1 Recombinant Protein (Human) is OPCA04709-20UG.

What sizes are available for SULT1A1 Recombinant Protein (Human)?

SULT1A1 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is SULT1A1 Recombinant Protein (Human) in stock?

SULT1A1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

SULT1A1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Sulfotransferase family 1A member 1

Gene Aliases

Aryl sulfotransferase 1; HAST1/HAST2; Phenol sulfotransferase 1; phenol-sulfating phenol sulfotransferase 1; P-PST; P-PST 1; PST; ST1A1; ST1A3; STP; STP1; sulfotransferase 1A1; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; Thermostable phenol sulfotransferase; thermostable phenol sulfotransferase1; ts-PST; TSPST1.

Gene ID

6817

Accession Number

NP_001046

Reactivity

Homo sapiens|Human

Target

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.

Type

Protein

Source

E.coli

Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.