Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H1F0 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

H1.0 linker histone

Gene Aliases

H1 histone family member 0; H1.0; H1.0, H1 (0), H1-0; H10; H1F0; H1FV; histone H1'; histone H1 (0) ; histone H1.0.

Gene ID

3005

Accession Number

NP_005309

Reactivity

Homo sapiens|Human

Target

Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.

Type

Protein

Source

E.coli

Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H1-0

Protein Name

Histone H1.0

Gene Name URL

H1-0

Nucleotide Accession Number

NM_005318

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM23 (NM_001077351) Human Tagged ORF Clone Lentiviral Particle
RC220281L3V 200 µL

RBM23 (NM_001077351) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tissue, Section, Human Adult Normal, Heart, Arcus Aortae (Frozen) HisTekTM
T5595-4919 5 Sections

Tissue, Section, Human Adult Normal, Heart, Arcus Aortae (Frozen) HisTekTM

Sign In for Pricing
View Details
SLAIN1 Human shRNA Plasmid Kit (Locus ID 122060)
TR315471 1 Kit

SLAIN1 Human shRNA Plasmid Kit (Locus ID 122060)

Sign In for Pricing
View Details
Sheep Nischarin ELISA Kit
MBS096443-01 48 Well

Sheep Nischarin ELISA Kit

Sign In for Pricing
View Details
Sheep Nischarin ELISA Kit
MBS096443-02 96 Well

Sheep Nischarin ELISA Kit

Sign In for Pricing
View Details
Sheep Nischarin ELISA Kit
MBS096443-03 5x 96 Well

Sheep Nischarin ELISA Kit

Sign In for Pricing
View Details