Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRPX2 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Sushi-repeat-containing protein, X-linked 2

Gene Aliases

1110039C07Rik; SRP; SRPUL; sushi repeat-containing protein SRPX2; sushi-repeat containing protein.

Gene ID

68792

Accession Number

NP_001077364

Reactivity

Mouse|Mus musculus

Target

Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords) . Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations.

Type

Protein

Source

E.coli

Sequence

WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

70.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Srpx2

Protein Name

Sushi repeat-containing protein SRPX2

Gene Name URL

Srpx2

Nucleotide Accession Number

NM_001083895

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Small integral membrane protein 6 (SMIM6) activation kit by CRISPRa
GA119132 1 Kit

Human Small integral membrane protein 6 (SMIM6) activation kit by CRISPRa

Sign In for Pricing
View Details
1700034E13Rik Mouse siRNA Oligo Duplex (Locus ID 78414)
SR401351 1 Kit

1700034E13Rik Mouse siRNA Oligo Duplex (Locus ID 78414)

Sign In for Pricing
View Details
Recombinant Human PITX1 Protein, N-His-SUMO
E55P2086 50 µg

Recombinant Human PITX1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Mouse Leptin receptor (LEPR) ELISA Kit
MBS7202174-01 48 Well

Mouse Leptin receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details
Mouse Leptin receptor (LEPR) ELISA Kit
MBS7202174-02 96 Well

Mouse Leptin receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details
Mouse Leptin receptor (LEPR) ELISA Kit
MBS7202174-03 5x 96 Well

Mouse Leptin receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details