Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU5F1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

POU class 5 homeobox 1

Gene Aliases

Oct-3; OCT3; Oct-4; OCT4; octamer-binding protein 3; octamer-binding protein 4; octamer-binding transcription factor 3; OTF3; OTF-3; OTF4; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; POU-type homeodomain-containing DNA-binding protein.

Gene ID

5460

Accession Number

NP_001272916

Reactivity

Homo sapiens|Human

Target

Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') . Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.

Type

Protein

Source

E.coli

Sequence

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

POU5F1

Protein Name

POU domain, class 5, transcription factor 1

Gene Name URL

POU5F1

Nucleotide Accession Number

NM_001285987

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM5D Polyclonal Antibody
E44H09381 100 µL

KDM5D Polyclonal Antibody

Sign In for Pricing
View Details
PRF1 antibody
70R-19510 50 ul

PRF1 antibody

Sign In for Pricing
View Details
Compound NP-021352
MBS5793682 Inquire

Compound NP-021352

Sign In for Pricing
View Details
Human Prostaglandin I Synthase ELISA Kit
MBS764794-01 48 Well

Human Prostaglandin I Synthase ELISA Kit

Sign In for Pricing
View Details
Human Prostaglandin I Synthase ELISA Kit
MBS764794-02 96 Well

Human Prostaglandin I Synthase ELISA Kit

Sign In for Pricing
View Details
Human Prostaglandin I Synthase ELISA Kit
MBS764794-03 5x 96 Well

Human Prostaglandin I Synthase ELISA Kit

Sign In for Pricing
View Details