Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODAM Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Odontogenic, ameloblast associated

Gene Aliases

APIN; odontogenic ameloblast-associated protein; odontogenic, ameloblast asssociated.

Gene ID

54959

Accession Number

NP_060325

Reactivity

Homo sapiens|Human

Target

Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.

Type

Protein

Source

E.coli

Sequence

APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ODAM

Protein Name

Odontogenic ameloblast-associated protein

Gene Name URL

ODAM

Nucleotide Accession Number

NM_017855

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT4 Mouse Monoclonal Antibody [Clone:7D7]
E45M14317 100 µg

CNOT4 Mouse Monoclonal Antibody [Clone:7D7]

Sign In for Pricing
View Details
LIF Antibody (Center) Blocking Peptide
MBS9226465-01 0.5 mg

LIF Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
LIF Antibody (Center) Blocking Peptide
MBS9226465-02 5x 0.5 mg

LIF Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Palmitelaidic Acid
orb1307002-01 1 mg

Palmitelaidic Acid

Sign In for Pricing
View Details
Palmitelaidic Acid
orb1307002-02 5 mg

Palmitelaidic Acid

Sign In for Pricing
View Details
Palmitelaidic Acid
orb1307002-03 10 mg

Palmitelaidic Acid

Sign In for Pricing
View Details