Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASA Recombinant Protein (Pseudomonas aeruginosa)

Product Specifications

CAS Number

9000-83-3

Gene Name

Protease LasA

Gene Aliases

PA1871; protease LasA; Staphylolytic protease.

Gene ID

878260

Accession Number

NP_250562

Reactivity

Pseudomonas aeruginosa

Target

Involved in proteolysis and elastolysis (degradation of the host protein elastin) . Has staphylolytic activity (degrades pentaglycine cross-links in cell wall peptidogylcan), preferring Gly-Gly-|-X substrates where X is Ala or Gly (PubMed:11179971) . Enhances the elastolytic but not proteolytic activity of elastase (lasB) and elastolytic activity of other proteases (PubMed:2110137) . Degradation of host elastin is likely to contribute to the pathogenicity of P.aeruginosa. While either His-317 or His-356 can abstract a proton in the hydrolysis reaction, the same residue performs both functions in a given catalytic cycle, with the other stabilizing the catalytic intermediate (PubMed:20026068) .

Type

Protein

Source

E.coli

Sequence

APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36 kda

Protein Length

Recombinant

NCBI Gene Symbol

LasA

Protein Name

Protease LasA

Gene Name URL

LasA

Nucleotide Accession Number

NC_002516

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LMO2 Antibody (LMO2/1971) [DyLight 680]
NBP3-08268FR 100 µL

Mouse Monoclonal LMO2 Antibody (LMO2/1971) [DyLight 680]

Sign In for Pricing
View Details
CENH3 Antibody
PHY6592A 150 μg

CENH3 Antibody

Sign In for Pricing
View Details
Human FGF3 (Fibroblast Growth Factor 3) ELISA Kit
RE2694H-01 48 Tests

Human FGF3 (Fibroblast Growth Factor 3) ELISA Kit

Sign In for Pricing
View Details
Human FGF3 (Fibroblast Growth Factor 3) ELISA Kit
RE2694H-02 96 Tests

Human FGF3 (Fibroblast Growth Factor 3) ELISA Kit

Sign In for Pricing
View Details
TRAFD1 Protein Vector (Mouse) (pPM-C-His)
PV241165 500 ng

TRAFD1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
miRZip-155 anti-miR-155 microRNA construct
MZIP155-PA-1 Bacterial Streak

miRZip-155 anti-miR-155 microRNA construct

Sign In for Pricing
View Details