Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer capsid glycoprotein VP7 Recombinant Protein (Rotavirus A)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Outer capsid glycoprotein VP7

Reactivity

Human Rotavirus A|Rotavirus A

Target

Calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca (2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.

Type

Protein

Source

E.coli

Sequence

QNYGINLPITGSMDTAYANSTQDNNFLFSTLCLYYPSEAPTQISDTEWKDTLSQLFLTKGWPTGSVYFNEYSNVLEFSIDPKLYCDYNVVLIRFVSGEELDISELADLILNEWLCNPMDITLYYYQQTGEANKWISMGSSCTVKVCPLNTQTLGIGCQTTNTATFETVADSEKLAIIDVVDSVNHKLNITSTTCTIRNCNKLGPRENVAIIQVGGSNILDITADPTTSPQTERMMRVNWKKWWQVFYTVVDYINQIVQVMSKRSRSLDSSSFYYRV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.3 kDa

Protein Length

Recombinant

Protein Name

Outer capsid glycoprotein VP7

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-RPS27 antibody
STJ28812 100 µl

Anti-RPS27 antibody

Ask
View Details
CD147 (EMMPRIN, Neurothelin, 5A11 Antigen, 5F7, Basigin, Blood brain barrier HT7 antigen BSG, Extracellular Matrix Metalloproteinase Inducer (EMMPRIN), Leukocyte Activation Antigen M6, Neurothelin, OK Blood Group Antigen, TCSF, Tumor Cell-derived Collagenase Stimulatory Factor) (BSA & Azide Free) (MaxLight 490)
168666-AF-ML490 100 µL

CD147 (EMMPRIN, Neurothelin, 5A11 Antigen, 5F7, Basigin, Blood brain barrier HT7 antigen BSG, Extracellular Matrix Metalloproteinase Inducer (EMMPRIN), Leukocyte Activation Antigen M6, Neurothelin, OK Blood Group Antigen, TCSF, Tumor Cell-derived Collagenase Stimulatory Factor) (BSA & Azide Free) (MaxLight 490)

Ask
View Details
RNF166 siRNA Oligos set (Human)
40265171 3x 5 nmol

RNF166 siRNA Oligos set (Human)

Ask
View Details
Recombinant Human MEMO1
P7031-01 50 µg

Recombinant Human MEMO1

Ask
View Details
Recombinant Human MEMO1
P7031-02 200 µg

Recombinant Human MEMO1

Ask
View Details
Recombinant Human MEMO1
P7031-03 1 mg

Recombinant Human MEMO1

Ask
View Details