Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERAP1 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Endoplasmic reticulum aminopeptidase 1

Gene Aliases

Adipocyte-derived leucine aminopeptidase; A-LAP; aminopeptidase PILS; Ar; Arts1; ARTS-1; E; endoplasmic reticulum aminopeptidase 1; ERAAP; PILSA; PILSAP; puromycin-insensitive leucyl-specific aminopeptidase; type 1 tumor necrosis factor receptor shedding aminopeptidase regulator; VEGF-induced aminopeptidase.

Gene ID

80898

Accession Number

NP_109636

Reactivity

Mouse|Mus musculus

Target

Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney (By similarity) .

Type

Protein

Source

E.coli

Sequence

PCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Erap1

Protein Name

Endoplasmic reticulum aminopeptidase 1

Gene Name URL

Erap1

Nucleotide Accession Number

NM_030711

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Astrotactin-1 (ASTN1) ELISA Kit
MBS7248482-01 48 Well

Porcine Astrotactin-1 (ASTN1) ELISA Kit

Sign In for Pricing
View Details
Porcine Astrotactin-1 (ASTN1) ELISA Kit
MBS7248482-02 96 Well

Porcine Astrotactin-1 (ASTN1) ELISA Kit

Sign In for Pricing
View Details
Porcine Astrotactin-1 (ASTN1) ELISA Kit
MBS7248482-03 5x 96 Well

Porcine Astrotactin-1 (ASTN1) ELISA Kit

Sign In for Pricing
View Details
Porcine Astrotactin-1 (ASTN1) ELISA Kit
MBS7248482-04 10x 96 Well

Porcine Astrotactin-1 (ASTN1) ELISA Kit

Sign In for Pricing
View Details
Sanbr Mouse siRNA Oligo Duplex (Locus ID 71675)
SR418211 1 Kit

Sanbr Mouse siRNA Oligo Duplex (Locus ID 71675)

Sign In for Pricing
View Details
MYF6 Antibody
E043952 100 µg -100 µL

MYF6 Antibody

Sign In for Pricing
View Details