Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Non-structural polyprotein?Partial Recombinant Protein (CHIKV)

Product Specifications

CAS Number

9000-83-3

Gene Name

Nonstructural polyprotein

Gene Aliases

CHIKVgp1; nonstructural polyprotein; Polyprotein nsP1234.

Gene ID

956309

Reactivity

Chikungunya virus|Chikungunya Virus

Target

P123 is short-lived polyproteins, accumulating during early stage of infection. It localizes the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, it starts viral genome replication into antigenome. After these early events, P123 is cleaved sequentially into nsP1, nsP2 and nsP3. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex (By similarity) .

Type

Protein

Source

E.coli

Sequence

DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CHIKVgp1

Protein Name

Non-structural polyprotein

Gene Name URL

CHIKVgp1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL22A1 Human Gene Knockout Kit (CRISPR)
KN420741 1 Kit

COL22A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MIR4536-1 ORF Vector (Human) (pORF)
ORF024452 1.0 µg DNA

MIR4536-1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PLA2G2A Protein Vector (Rat) (pPB-N-His)
PV294327 500 ng

PLA2G2A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CD2 (Erythrocyte receptor, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte function antigen 2, Rosette receptor, SRBC, T-cell surface antigen CD2, T-cell surface antigen T11/Leu-5, T11) (BSA & Azide Free) (MaxLight 750) discontinued
168673-AF-ML750 100 µL

CD2 (Erythrocyte receptor, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte function antigen 2, Rosette receptor, SRBC, T-cell surface antigen CD2, T-cell surface antigen T11/Leu-5, T11) (BSA & Azide Free) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rac-3-Acetylthio-2-methylpropionyl Chloride-d5
464289-01 1 mg

Rac-3-Acetylthio-2-methylpropionyl Chloride-d5

Sign In for Pricing
View Details
Rac-3-Acetylthio-2-methylpropionyl Chloride-d5
464289-02 2.5 mg

Rac-3-Acetylthio-2-methylpropionyl Chloride-d5

Sign In for Pricing
View Details