Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL4 Recombinant Protein (Cynomolgus monkey)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

B-cell stimulatory factor 1; Lymphocyte stimulatory factor 1.

Reactivity

Cynomolgus Monkey|Macaca fascicularis

Target

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Type

Protein

Source

Yeast

Sequence

HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL4

Protein Name

Interleukin-4

Gene Name URL

IL4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S,5R) -2- (tert-butoxycarbonyl) -2-azabicyclo[3.1.0]hexane-1-carboxylic acid
sc-334367 250 mg

(1S,5R) -2- (tert-butoxycarbonyl) -2-azabicyclo[3.1.0]hexane-1-carboxylic acid

Sign In for Pricing
View Details
POLR1B Adenovirus (Human)
37167051 1.0 mL

POLR1B Adenovirus (Human)

Sign In for Pricing
View Details
Multi-drug 9 drugs Rapid Test Device – Saliva
D-DOAM9S 10 Tests

Multi-drug 9 drugs Rapid Test Device – Saliva

Sign In for Pricing
View Details
PATE3 Antibody
MBS8501613-01 0.1 mL

PATE3 Antibody

Sign In for Pricing
View Details
PATE3 Antibody
MBS8501613-02 0.1 mL (AF405L)

PATE3 Antibody

Sign In for Pricing
View Details
PATE3 Antibody
MBS8501613-03 0.1 mL (AF405S)

PATE3 Antibody

Sign In for Pricing
View Details