Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A1 Recombinant Protein (Rat)

Product Specifications

CAS Number

9000-83-3

Gene Name

Sulfotransferase family 1A member 1

Gene Aliases

Aryl sulfotransferase; Aryl sulfotransferase cytosolic, 1A, phenol-preferring, member 3; aryl sulfotransferase IV; ASTIV; minoxidil sulfotransferase; Mx-ST; Phenol sulfotransferase; Phenol sulfotransferase 1a1; PST-1; St1a1; Stm; Stp1; sulfokinase; sulfotransferase 1A1; sulfotransferase family 1A, phenol-preferring, member 1; sulfotransferase family, cytosolic, 1A, phenol preferring; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1; sulphotransferase family cytosolic 1A phenol-prefering member 1; Sult1a3; tyrosine-ester sulfotransferase.

Gene ID

83783

Reactivity

Rat|Rattus norvegicus

Target

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.

Type

Protein

Source

E.coli

Sequence

MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Sult1a1

Protein Name

Sulfotransferase 1A1

Gene Name URL

Sult1a1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIF1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
11596156 3x 1.0 µg DNA

AIF1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
EGFR (F4) Alexa Fluor® 647
sc-53274 AF647 200 µg/mL

EGFR (F4) Alexa Fluor® 647

Sign In for Pricing
View Details
MAP2 (Microtubule-associated Protein 2, MAP2A, MAP2B, MAP2C) (Biotin)
MBS6425332-01 0.1 mL

MAP2 (Microtubule-associated Protein 2, MAP2A, MAP2B, MAP2C) (Biotin)

Sign In for Pricing
View Details
MAP2 (Microtubule-associated Protein 2, MAP2A, MAP2B, MAP2C) (Biotin)
MBS6425332-02 5x 0.1 mL

MAP2 (Microtubule-associated Protein 2, MAP2A, MAP2B, MAP2C) (Biotin)

Sign In for Pricing
View Details
HSF1 Antibody, Clone 10H4: ATTO 488
SMC-476D-A488 100 µg

HSF1 Antibody, Clone 10H4: ATTO 488

Sign In for Pricing
View Details
Human TUSC3 (NM_178234) AAV Particle
RC203082A1V 250 µL

Human TUSC3 (NM_178234) AAV Particle

Sign In for Pricing
View Details