Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL4 Recombinant Protein (Sheep)

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 4

Gene Aliases

B-cell stimulatory factor 1; BSF-1; IL-4; interleukin-4; lymphocyte stimulatory factor 1.

Gene ID

101122781

Accession Number

NP_001009313

Reactivity

Ovis aries|Sheep

Target

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Type

Protein

Source

E.coli

Sequence

HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL4

Protein Name

Interleukin-4

Gene Name URL

IL4

Nucleotide Accession Number

NM_001009313

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Integrin alpha-L, ITGAL ELISA Kit
MBS1605089-01 48 Well

Mouse Integrin alpha-L, ITGAL ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin alpha-L, ITGAL ELISA Kit
MBS1605089-02 96 Well

Mouse Integrin alpha-L, ITGAL ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin alpha-L, ITGAL ELISA Kit
MBS1605089-03 5x 96 Well

Mouse Integrin alpha-L, ITGAL ELISA Kit

Sign In for Pricing
View Details
Mouse Integrin alpha-L, ITGAL ELISA Kit
MBS1605089-04 10x 96 Well

Mouse Integrin alpha-L, ITGAL ELISA Kit

Sign In for Pricing
View Details
Bovine Protein Kinase Inhibitor Gamma ELISA Kit
MBS751855-01 48 Well

Bovine Protein Kinase Inhibitor Gamma ELISA Kit

Sign In for Pricing
View Details
Bovine Protein Kinase Inhibitor Gamma ELISA Kit
MBS751855-02 96 Well

Bovine Protein Kinase Inhibitor Gamma ELISA Kit

Sign In for Pricing
View Details