Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC6 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Histone deacetylase 6

Gene Aliases

CPBHM; HD6; histone deacetylase 6; JM21; PPP1R90; protein phosphatase 1, regulatory subunit 90; tubulin-lysine deacetylase HDAC6.

Gene ID

10013

Accession Number

NP_001308155

Reactivity

Homo sapiens|Human

Target

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity) . Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.

Type

Protein

Source

E.coli

Sequence

MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

70.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HDAC6

Protein Name

Histone deacetylase 6

Gene Name URL

HDAC6

Nucleotide Accession Number

NM_001321226

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)
MBS1353669-01 0.02 mg (E-Coli)

Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)

Sign In for Pricing
View Details
Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)
MBS1353669-02 0.02 mg (Yeast)

Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)

Sign In for Pricing
View Details
Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)
MBS1353669-03 0.1 mg (E-Coli)

Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)

Sign In for Pricing
View Details
Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)
MBS1353669-04 0.1 mg (Yeast)

Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)

Sign In for Pricing
View Details
Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)
MBS1353669-05 0.02 mg (Baculovirus)

Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)

Sign In for Pricing
View Details
Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)
MBS1353669-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)

Sign In for Pricing
View Details