Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-actitoxin-Avd1c Recombinant Protein (Mediterranean snakelocks sea anemone)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Anemonia sulcata toxin 2; ATX-II; Neurotoxin 2; Toxin II.

Reactivity

Anemonia sulcata|Snake-locks Sea Anemone

Target

Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC (50) =6.01 nM) and Nav1.2/SCN2A (EC (50) =7.88 nM) (PubMed:15169781) . It has also great activity on Nav1.5/SCN5A (EC (50) =49.05 nM), Nav1.4/SCN4A (EC (50) =109.49 nM) and Nav1.6/SCN8A (EC (50) =about 180 nM) and is less potent on Nav1.3/SCN3A (EC (50) =759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781) .

Type

Protein

Source

Yeast

Sequence

GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

6.9 kDa

Protein Length

Recombinant

Protein Name

Delta-actitoxin-Avd1c

More Discoveries

Explore Other Products

Browse additional items from our catalog

6X Agarose gel loading buffer Type IV
IBS-BA009 10 mL

6X Agarose gel loading buffer Type IV

Sign In for Pricing
View Details
Frataxin (FXN) Mouse Monoclonal Antibody [Clone ID: OTI1F2]
TA504256S 30 µL

Frataxin (FXN) Mouse Monoclonal Antibody [Clone ID: OTI1F2]

Sign In for Pricing
View Details
Mouse Eif2ak3 Pre-designed siRNA Set B
SI104163B 1 Each

Mouse Eif2ak3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MBL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1275107 1.0 µg DNA

MBL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
EDC3, ID (EDC3, LSM16, YJDC, YJEFN2, Enhancer of mRNA-decapping protein 3, LSM16 homolog, YjeF N-terminal domain-containing protein 2, YjeF domain-containing protein 1) (MaxLight 405)
MBS6294329-01 0.1 mL

EDC3, ID (EDC3, LSM16, YJDC, YJEFN2, Enhancer of mRNA-decapping protein 3, LSM16 homolog, YjeF N-terminal domain-containing protein 2, YjeF domain-containing protein 1) (MaxLight 405)

Sign In for Pricing
View Details
EDC3, ID (EDC3, LSM16, YJDC, YJEFN2, Enhancer of mRNA-decapping protein 3, LSM16 homolog, YjeF N-terminal domain-containing protein 2, YjeF domain-containing protein 1) (MaxLight 405)
MBS6294329-02 5x 0.1 mL

EDC3, ID (EDC3, LSM16, YJDC, YJEFN2, Enhancer of mRNA-decapping protein 3, LSM16 homolog, YjeF N-terminal domain-containing protein 2, YjeF domain-containing protein 1) (MaxLight 405)

Sign In for Pricing
View Details