Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-actitoxin-Avd1c Recombinant Protein (Mediterranean snakelocks sea anemone)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Anemonia sulcata toxin 2; ATX-II; Neurotoxin 2; Toxin II.

Reactivity

Anemonia sulcata|Snake-locks Sea Anemone

Target

Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC (50) =6.01 nM) and Nav1.2/SCN2A (EC (50) =7.88 nM) (PubMed:15169781) . It has also great activity on Nav1.5/SCN5A (EC (50) =49.05 nM), Nav1.4/SCN4A (EC (50) =109.49 nM) and Nav1.6/SCN8A (EC (50) =about 180 nM) and is less potent on Nav1.3/SCN3A (EC (50) =759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781) .

Type

Protein

Source

Yeast

Sequence

GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

6.9 kDa

Protein Length

Recombinant

Protein Name

Delta-actitoxin-Avd1c

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR149 (NM_001038705) Human Tagged Lenti ORF Clone
RC223772L1 10 µg

GPR149 (NM_001038705) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Nfkb2 shRNA (UAS) - Lentiviral mouse Nfkb2 shRNA (UAS, GFP) (100)
GTR15265473 1 Vial

Lentiviral mouse Nfkb2 shRNA (UAS) - Lentiviral mouse Nfkb2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Membrane Protein 2, Palmitoylated (MPP2, MAGUK p55 Subfamily Member 2, Protein MPP2, Discs Large Homolog 2, DLG2, DKFZp686J2189, DKFZp761D0712, DKFZp686A06252) (MaxLight 550) discontinued
M2873-06-ML550 100 µL

Membrane Protein 2, Palmitoylated (MPP2, MAGUK p55 Subfamily Member 2, Protein MPP2, Discs Large Homolog 2, DLG2, DKFZp686J2189, DKFZp761D0712, DKFZp686A06252) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human fFN (Fetal Fibronectin) Microsample ELISA Kit
ELK0675MS-01 48 Tests

Human fFN (Fetal Fibronectin) Microsample ELISA Kit

Sign In for Pricing
View Details
Human fFN (Fetal Fibronectin) Microsample ELISA Kit
ELK0675MS-02 96 Tests

Human fFN (Fetal Fibronectin) Microsample ELISA Kit

Sign In for Pricing
View Details
Human fFN (Fetal Fibronectin) Microsample ELISA Kit
ELK0675MS-03 5x 96 Tests

Human fFN (Fetal Fibronectin) Microsample ELISA Kit

Sign In for Pricing
View Details