Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS15 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Transmembrane protease, serine 15

Gene Aliases

Enterokinase; enteropeptidase; Entk; P; protease, serine, 7 (enterokinase) ; Prss7; Serine protease 7; Transmembrane protease serine 15.

Gene ID

19146

Reactivity

Mouse|Mus musculus

Target

Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A) . It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases (By similarity) .

Type

Protein

Source

E.coli

Sequence

IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Tmprss15

Protein Name

Enteropeptidase

Gene Name URL

Tmprss15

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Collagen Type IV Alpha 3 ELISA Kit
MBS051321-01 48 Well

Rat Collagen Type IV Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type IV Alpha 3 ELISA Kit
MBS051321-02 96 Well

Rat Collagen Type IV Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type IV Alpha 3 ELISA Kit
MBS051321-03 5x 96 Well

Rat Collagen Type IV Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type IV Alpha 3 ELISA Kit
MBS051321-04 10x 96 Well

Rat Collagen Type IV Alpha 3 ELISA Kit

Sign In for Pricing
View Details
ZNF682 Antibody
C10241-01 50 μL

ZNF682 Antibody

Sign In for Pricing
View Details
ZNF682 Antibody
C10241-02 100 µL

ZNF682 Antibody

Sign In for Pricing
View Details