Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFD Recombinant Protein (Rat)

Product Specifications

CAS Number

9000-83-3

Gene Name

Complement factor D

Gene Aliases

Adipsin; Adn; C3 convertase activator; complement factor D; D component of complement (adipsin) ; Df; endogenous vascular elastase; EVE; properdin factor D.

Gene ID

54249

Accession Number

NP_001071110

Reactivity

Rat|Rattus norvegicus

Target

Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.

Type

Protein

Source

E.coli

Sequence

ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cfd

Protein Name

Complement factor D

Gene Name URL

Cfd

Nucleotide Accession Number

NM_001077642

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp366 Recombinant Protein (Mouse)
RP186992 100 µg

Zfp366 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)
MBS1131982-01 0.02 mg (E-Coli)

Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)
MBS1131982-02 0.02 mg (Yeast)

Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)
MBS1131982-03 0.1 mg (E-Coli)

Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)
MBS1131982-04 0.1 mg (Yeast)

Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)
MBS1131982-05 0.02 mg (Baculovirus)

Recombinant Azotobacter vinelandii Molybdenum storage protein subunit beta (mosB)

Sign In for Pricing
View Details