Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parvalbumin beta-1 Recombinant Protein (Gadus chalcogrammus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen: The c 1

Reactivity

Gadus chalcogrammus

Target

In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity) .

Type

Protein

Source

E.coli

Sequence

SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.4 kDa

Protein Length

Recombinant

Protein Name

Parvalbumin beta-1

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2W siRNA Oligos set (Human)
49012171 3x 5 nmol

UBE2W siRNA Oligos set (Human)

Sign In for Pricing
View Details
Ggnbp2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7129805 3x 1.0 µg

Ggnbp2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Monoclonal CD58/LFA-3 Antibody (186) [DyLight 550]
NBP2-90099R 0.1 mL

Rabbit Monoclonal CD58/LFA-3 Antibody (186) [DyLight 550]

Sign In for Pricing
View Details
LOX , ID (LOX, Protein-lysine 6-oxidase, Lysyl oxidase) (MaxLight 550) discontinued
031090-ML550 100 µL

LOX , ID (LOX, Protein-lysine 6-oxidase, Lysyl oxidase) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-TIGD1 / EEYORE antibody
STJ70504 100 µg

Anti-TIGD1 / EEYORE antibody

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum Tubulin beta chain Protein (aa 1-445) (isolate K1 / Thailand)
VAng-Wyb6888-50gEcoli 50 µg (E. coli)

Recombinant Plasmodium Falciparum Tubulin beta chain Protein (aa 1-445) (isolate K1 / Thailand)

Sign In for Pricing
View Details