Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parvalbumin beta-1 Recombinant Protein (Gadus chalcogrammus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen: The c 1

Reactivity

Gadus chalcogrammus

Target

In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity) .

Type

Protein

Source

E.coli

Sequence

SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.4 kDa

Protein Length

Recombinant

Protein Name

Parvalbumin beta-1

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPH3 sgRNA CRISPR Lentivector (Human) (Target 1)
K2073902 1.0 µg DNA

RSPH3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Chicken Occludin (OCLN) ELISA Kit
abx517212 96 Well

Chicken Occludin (OCLN) ELISA Kit

Sign In for Pricing
View Details
CSN2 Antibody
A76474-50UL 50 μL

CSN2 Antibody

Sign In for Pricing
View Details
Human SMOX Knockout A549 cell line
GTR15416743 1 Vial

Human SMOX Knockout A549 cell line

Sign In for Pricing
View Details
GUCA1B Rabbit pAb
A14739 20 µL

GUCA1B Rabbit pAb

Sign In for Pricing
View Details
ANXA3 (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3)
A2295-28D 100 µg

ANXA3 (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3)

Sign In for Pricing
View Details