Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

COP9 signalosome subunit 2

Gene Aliases

ALIEN; alien homolog; COP9 constitutive photomorphogenic homolog subunit 2; COP9 signalosome complex subunit 2; CSN2; JAB1-containing signalosome subunit 2; SGN2; signalosome subunit 2; thyroid receptor-interacting protein 15; TR-interacting protein 15; TRIP15; TRIP-15.

Gene ID

9318

Accession Number

NP_001137359

Reactivity

Homo sapiens|Human

Target

Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.

Type

Protein

Source

E.coli

Sequence

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

67.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

COPS2

Protein Name

COP9 signalosome complex subunit 2

Gene Name URL

COPS2

Nucleotide Accession Number

NM_001143887

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
MBS1604244-01 48 Well

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
MBS1604244-02 96 Well

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
MBS1604244-03 5x 96 Well

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit
MBS1604244-04 10x 96 Well

Monkey Vascular Endothelial cell Growth Factor, VEGF ELISA Kit

Sign In for Pricing
View Details
CYP2D6 Antibody
orb195160-01 50 μL

CYP2D6 Antibody

Sign In for Pricing
View Details
CYP2D6 Antibody
orb195160-02 100 µL

CYP2D6 Antibody

Sign In for Pricing
View Details