Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF160 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Zinc finger protein 160

Gene Aliases

F11; HKr18; HZF5; KR18; KRAB zinc finger protein KR18; zinc finger protein 160; zinc finger protein 5; zinc finger protein HZF5; zinc finger protein Kr18.

Gene ID

90338

Reactivity

Homo sapiens|Human

Target

May be involved in transcriptional regulation.

Type

Protein

Source

E.coli

Sequence

MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ZNF160

Protein Name

Zinc finger protein 160

Gene Name URL

ZNF160

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU2F1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37257124 3x 1.0µg DNA

POU2F1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Phospho-MAP3K8 (Thr290) Antibody Blocking Peptide
orb1505066 500 µg

Phospho-MAP3K8 (Thr290) Antibody Blocking Peptide

Sign In for Pricing
View Details
Clec14a (NM_001014077) Rat Tagged Lenti ORF Clone
RR205904L4 10 µg

Clec14a (NM_001014077) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cltb sgRNA CRISPR Lentivector (Rat) (Target 1)
K7579002 1.0 µg DNA

Cltb sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Olfr1448 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4230102 1.0 µg DNA

Olfr1448 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Guinea pig N-acetylated alpha-linked acidic dipeptidase-like 1 (NAALADL1) ELISA Kit
MBS2613140-01 48 Well

Guinea pig N-acetylated alpha-linked acidic dipeptidase-like 1 (NAALADL1) ELISA Kit

Sign In for Pricing
View Details