Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein phosphatase 1 catalytic subunit beta

Gene Aliases

Epididymis secretory sperm binding protein Li 80p; HEL-S-80p; MP; myosin phosphatase; NSLH2; PP1B; PP-1B; PP1beta; PP1c; PPP1beta; PPP1CD; protein phosphatase 1, catalytic subunit, beta isozyme; protein phosphatase 1-beta; protein phosphatase 1-delta; serine/threonine-protein phosphatase PP1-beta catalytic subunit.

Gene ID

5500

Accession Number

NP_002700

Reactivity

Homo sapiens|Human

Target

Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208) .

Type

Protein

Source

E.coli

Sequence

ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPP1CB

Protein Name

Serine/threonine-protein phosphatase PP1-beta catalytic subunit

Gene Name URL

PPP1CB

Nucleotide Accession Number

NM_002709

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCHIP1 antibody
10R-7163 100 ul

SCHIP1 antibody

Sign In for Pricing
View Details
Marlin-1 Double Nickase Plasmid (m)
sc-429252-NIC 20 µg

Marlin-1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Templates Of Curves
2014520/9 1 Each

Templates Of Curves

Sign In for Pricing
View Details
Mouse Monoclonal EZH2 Antibody
TA347124 50 µg

Mouse Monoclonal EZH2 Antibody

Sign In for Pricing
View Details
Cytochrome P450 2B6 (CYP2B6) Rabbit Polyclonal Antibody
TA324379 400 µL

Cytochrome P450 2B6 (CYP2B6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gly-Gln-OH·H2O
238783-01 1 g

Gly-Gln-OH·H2O

Sign In for Pricing
View Details