Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGMN Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Legumain

Gene Aliases

A; AEP; AI746452; asparaginyl endopeptidase; AU022324; legumain; Pr; preprolegumain; Protease, cysteine 1; protease, cysteine, 1; Prsc1.

Gene ID

19141

Accession Number

NP_035305

Reactivity

Mouse|Mus musculus

Target

Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation.

Type

Protein

Source

E.coli

Sequence

VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Lgmn

Protein Name

Legumain

Gene Name URL

Lgmn

Nucleotide Accession Number

NM_011175

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)
MBS1245758-01 0.02 mg (E-Coli)

Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)
MBS1245758-02 0.1 mg (E-Coli)

Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)
MBS1245758-03 0.02 mg (Yeast)

Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)
MBS1245758-04 0.1 mg (Yeast)

Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)
MBS1245758-05 0.02 mg (Baculovirus)

Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)
MBS1245758-06 0.02 mg (Mammalian-Cell)

Recombinant Bartonella bacilliformis GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details