Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSM34 Recombinant Protein (Mouse-ear cress)

Product Specifications

CAS Number

9000-83-3

Gene Name

Osmotin 34

Gene Aliases

AT4G11650; ATOSM34; osmotin 34; T5C23.80; T5C23_80.

Gene ID

826770

Reactivity

Arabidopsis thaliana

Type

Protein

Source

E.coli

Sequence

ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

OSM34

Protein Name

Osmotin-like protein OSM34

Gene Name URL

OSM34

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf70 CRISPR All-in-one AAV vector set (with saCas9)(Human)
14429151 3x 1.0 µg DNA

C2orf70 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human Aurora Kinase B (AURKB) ELISA Kit
TRV-0002690 96 Well Plate

Human Aurora Kinase B (AURKB) ELISA Kit

Sign In for Pricing
View Details
GLI2 antibody - middle region (ARP31885_P050)
ARP31885_P050 100 µL

GLI2 antibody - middle region (ARP31885_P050)

Sign In for Pricing
View Details
CPZ Antibody
45852-01 50 µL

CPZ Antibody

Sign In for Pricing
View Details
CPZ Antibody
45852-02 100 µL

CPZ Antibody

Sign In for Pricing
View Details
HPK1 CRISPR/Cas9 KO Plasmid (h2)
sc-402367-KO-2 20 µg

HPK1 CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details