Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOLPIB Recombinant Protein (Lolium perenne)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Lol p Ib; Allergen Lol p Va.

Reactivity

Lolium perenne

Type

Protein

Source

E.coli

Sequence

ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LOLPIB

Protein Name

Major pollen allergen Lol p 5a

Gene Name URL

LOLPIB

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-100 1x 100 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
BNC940031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details