Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF4 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Platelet factor 4

Gene Aliases

Chemokine (C-X-C motif) ligand 4; C-X-C motif chemokine 4; Cxcl; Cxcl4; Pf; PF-4; platelet factor 4; Scyb; Scyb4.

Gene ID

56744

Accession Number

NP_064316

Reactivity

Mouse|Mus musculus

Target

Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation (By similarity) .

Type

Protein

Source

E.coli

Sequence

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Pf4

Protein Name

Platelet factor 4

Gene Name URL

Pf4

Nucleotide Accession Number

NM_019932

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat rno-miR-33-5p miRNA Antagomir
abx889820-01 10 nmol

Rat rno-miR-33-5p miRNA Antagomir

Sign In for Pricing
View Details
Rat rno-miR-33-5p miRNA Antagomir
abx889820-02 20 nmol

Rat rno-miR-33-5p miRNA Antagomir

Sign In for Pricing
View Details
Human Eukaryotic Translation Initiation Factor 5A2 (EIF5A2) ELISA Kit
EKU10812 96 Tests

Human Eukaryotic Translation Initiation Factor 5A2 (EIF5A2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human COG8 shRNA (UAS) - Lentiviral human COG8 shRNA (UAS, RFP) plasmid
GTR15350836 1 Vial

Lentiviral human COG8 shRNA (UAS) - Lentiviral human COG8 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Cytokeratin 7 (CK7)
MBS2129973 Inquire

PE Linked Monoclonal Antibody to Cytokeratin 7 (CK7)

Sign In for Pricing
View Details
RPL7AP18 AAV siRNA Pooled Vector
41792161 1.0 µg

RPL7AP18 AAV siRNA Pooled Vector

Sign In for Pricing
View Details