What is the catalog number for MSRB7 Recombinant Protein (Mouse-ear cress)?

The catalog number for MSRB7 Recombinant Protein (Mouse-ear cress) is OPCA04549-20UG.

What sizes are available for MSRB7 Recombinant Protein (Mouse-ear cress)?

MSRB7 Recombinant Protein (Mouse-ear cress) is available in the following size(s): 20 µg.

Is MSRB7 Recombinant Protein (Mouse-ear cress) in stock?

MSRB7 Recombinant Protein (Mouse-ear cress) is currently made to order / not held in immediate stock. Contact us for lead time.

MSRB7 Recombinant Protein (Mouse-ear cress)

Product Specifications

CAS Number

9000-83-3

Gene Name

Methionine sulfoxide reductase B7

Gene Aliases

AT4G21830; ATMSRB7; methionine sulfoxide reductase B7; Peptide-methionine (R) -S-oxide reductase; T8O5.40; T8O5_40.

Gene ID

828271

Reactivity

Arabidopsis thaliana

Target

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity) .

Type

Protein

Source

E.coli

Sequence

MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.