Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pollen allergen Phl p 5a Recombinant Protein (Common timothy)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Phl p Va.

Reactivity

Phleum pratense

Type

Protein

Source

E.coli

Sequence

ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.5 kDa

Protein Length

Recombinant

Protein Name

Pollen allergen Phl p 5a

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pus7 ORF Vector (Mouse) (pORF)
ORF055306 1.0 µg DNA

Pus7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
TCR (Tcell Receptor) Human ELISA Kit
H4910 96 Tests

TCR (Tcell Receptor) Human ELISA Kit

Sign In for Pricing
View Details
PCMV-3xFLAG-PFKM-Neo Plasmid
PVT63678 2 µg

PCMV-3xFLAG-PFKM-Neo Plasmid

Sign In for Pricing
View Details
Porcine deoxyuridinetriphate (DUTP) ELISA Kit
MBS265879-01 48 Well

Porcine deoxyuridinetriphate (DUTP) ELISA Kit

Sign In for Pricing
View Details
Porcine deoxyuridinetriphate (DUTP) ELISA Kit
MBS265879-02 96 Well

Porcine deoxyuridinetriphate (DUTP) ELISA Kit

Sign In for Pricing
View Details
Porcine deoxyuridinetriphate (DUTP) ELISA Kit
MBS265879-03 5x 96 Well

Porcine deoxyuridinetriphate (DUTP) ELISA Kit

Sign In for Pricing
View Details