Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HASA Recombinant Protein (Serratia marcescens)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Heme acquisition system protein A.

Reactivity

Serratia marcescens

Target

Can bind free heme and also acquire it from hemoglobin. Conveys heme from hemoglobin to the HasR receptor which releases it into the bacterium. HasR alone can take up heme but the synergy between HasA and HasR increases heme uptake 100-fold.

Type

Protein

Source

E.coli

Sequence

MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HASA

Protein Name

Hemophore HasA

Gene Name URL

HASA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-SNX7 antibody
SL12250R-01 50 µL

Rabbit Anti-SNX7 antibody

Sign In for Pricing
View Details
Rabbit Anti-SNX7 antibody
SL12250R-02 100 µL

Rabbit Anti-SNX7 antibody

Sign In for Pricing
View Details
Olfr891 Protein Lysate (Mouse) with C-HA Tag
33522034 100 µg

Olfr891 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PML (Promyelocytic Leukemia Protein) (FITC)
P4296-FITC 100 µL

PML (Promyelocytic Leukemia Protein) (FITC)

Sign In for Pricing
View Details
TOP1P1 Protein Vector (Human) (pPM-C-HA)
47304021 500 ng

TOP1P1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
HRP Goat Anti-Mouse IgG Fc
6292 1 mg

HRP Goat Anti-Mouse IgG Fc

Sign In for Pricing
View Details